Structure of PDB 2pxy Chain C Binding Site BS01

Receptor Information
>2pxy Chain C (length=183) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPE
FAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPV
LLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHK
LSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pxy Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'.
Resolution2.23 Å
Binding residue
(original residue number in PDB)		Y9 V11 F24 S53 F54 N62 T65 N69 V72
Binding residue
(residue number reindexed from 1)		Y11 V14 F27 S56 F57 N65 T68 N72 V75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pxy, PDBe:2pxy, PDBj:2pxy
PDBsum2pxy
PubMed17694060
UniProtP14438|HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) (Gene Name=H2-Aa)

[Back to BioLiP]