Structure of PDB 2poy Chain C Binding Site BS01

Receptor Information
>2poy Chain C (length=168) Species: 353152 (Cryptosporidium parvum Iowa II) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNPVVYFDISIGQTPAGRITMELFADKVPITAENFRALCTGEKGMGQSGK
PLCYTGSFFHRIIPQFMIQGGDFTRGDGTGGESIYGKFRDENFVYTHDAP
FLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGKVLEGMEVVKSIEKC
GSQNGKPTKSVCITASGV
Ligand information
>2poy Chain V (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2poy Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 in Complex with Cyclosporin A.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R78 F83 Q86 G95 A124 N125 A126 Q134 F136 W144 H149
Binding residue
(residue number reindexed from 1)		R61 F66 Q69 G78 A106 N107 A108 Q116 F118 W126 H131
Enzymatic activity
Catalytic site (original residue number in PDB) R78 F83 Q86 N125 F136 L145 H149
Catalytic site (residue number reindexed from 1) R61 F66 Q69 N107 F118 L127 H131
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2poy, PDBe:2poy, PDBj:2poy
PDBsum2poy
PubMed
UniProtA3FQA7

[Back to BioLiP]