Structure of PDB 2p6a Chain C Binding Site BS01

Receptor Information
>2p6a Chain C (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWM
IFNGGAPNCIPCKETCENVDCGPKCRMNKKNKPRCVCAPDCSNKGPVCGL
DGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQT
NNAYCVTCNRICPEPSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAY
EGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSDEPVCASD
NATYASECAMKEAACSSGVLLEVKHSGSCNSI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p6a Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R237 E265
Binding residue
(residue number reindexed from 1)		R231 E257
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0038102 activin receptor antagonist activity
GO:0043395 heparan sulfate proteoglycan binding
GO:0048185 activin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001501 skeletal system development
GO:0002244 hematopoietic progenitor cell differentiation
GO:0007276 gamete generation
GO:0007389 pattern specification process
GO:0008585 female gonad development
GO:0014070 response to organic cyclic compound
GO:0030154 cell differentiation
GO:0030509 BMP signaling pathway
GO:0030510 regulation of BMP signaling pathway
GO:0030857 negative regulation of epithelial cell differentiation
GO:0031069 hair follicle morphogenesis
GO:0032926 negative regulation of activin receptor signaling pathway
GO:0036305 ameloblast differentiation
GO:0042475 odontogenesis of dentin-containing tooth
GO:0043616 keratinocyte proliferation
GO:0051798 positive regulation of hair follicle development
GO:0071363 cellular response to growth factor stimulus
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2p6a, PDBe:2p6a, PDBj:2p6a
PDBsum2p6a
PubMed17409095
UniProtP19883|FST_HUMAN Follistatin (Gene Name=FST)

[Back to BioLiP]