Structure of PDB 2opz Chain C Binding Site BS01

Receptor Information
>2opz Chain C (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKV
KCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSL
EECLVRTTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2opz Structure-activity based study of the Smac-binding pocket within the BIR3 domain of XIAP.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
L292 K297 V298 G306 L307 T308 E314 Q319 W323
Binding residue
(residue number reindexed from 1)
L44 K49 V50 G58 L59 T60 E66 Q71 W75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:2opz, PDBe:2opz, PDBj:2opz
PDBsum2opz
PubMed17336535
UniProtP98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)

[Back to BioLiP]