Structure of PDB 2nz4 Chain C Binding Site BS01

Receptor Information
>2nz4 Chain C (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFV
IFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>2nz4 Chain R (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaccauugcacuccggugccaguugacgaggugggguuuaucgagauu
ucggcggaugacucccgguuguucaucacaaccgcaagcuuuuacuuaaa
ucauuaaggugacuuaguggacaaaggugaaagugugauga
<<<<<<..........>>>>>>......(((...<<<<<<..))).....
.........>>>>>><<<<<<.((((((>>>>>>...<<<<<<<<<....
<<<<<<<<....>>>>>>>.>....>>>>>>>>>.))))))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nz4 Structural Investigation of the GlmS Ribozyme Bound to Its Catalytic Cofactor
Resolution2.498 Å
Binding residue
(original residue number in PDB)		Y13 N16 E19 K22 K23 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y6 N9 E12 K15 K16 S41 L42 K43 M44 R45 Q47 F49 K73 Q78 A80 K81 T82 D83 S84 D85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2nz4, PDBe:2nz4, PDBj:2nz4
PDBsum2nz4
PubMed17196404
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]