Structure of PDB 2nra Chain C Binding Site BS01

Receptor Information

>2nra Chain C (length=252) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VNKKTKIRHRNELNHTLAQLPLPAKRVMYMALALIDSKEPLERGRVFKIR
AEDLAALAKITPSLAYRQLKEGGKLLGASKISLRGDDIIALAKELNSEEL
DLNIIEWIAYSPDEGYLSLKFTRTIEPYISSLIGKKNKFTTQLLTASLRL
SSQYSSSLYQLIRKHYSNFKKKNYFIISVDELKEELIAYTFDKDGNIEYK
YPDFPIFKRDVLNKAIAEIKKKTEISFVGFTVHEKEGRKISKLKFEFVVD
ED

Ligand information

>2nra Chain A (length=23) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaacatgagagcttagtacgtct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2nra Crystal structure of pi initiator protein-iteron complex of plasmid R6K: implications for initiation of plasmid DNA replication.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	L30 R34 T69 L72 R75 S167 F220 P221 K224 R225 K255 I256
Binding residue (residue number reindexed from 1)	L22 R26 T61 L64 R67 S151 F204 P205 K208 R209 K239 I240

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2nra, PDBe:2nra, PDBj:2nra
PDBsum	2nra
PubMed	17124167
UniProt	P03067\|PIR_ECOLX PI protein (Gene Name=pir)

[Back to BioLiP]