Structure of PDB 2nqp Chain C Binding Site BS01

Receptor Information
>2nqp Chain C (length=264) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCA
GRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDD
FHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLL
GENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRN
IVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRY
DLPKPPMGPLFLAD
Ligand information
>2nqp Chain F (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccggaugguggaaucgguagacacaagggauaaucccucggcgugcugug
cggguucaagucccgcuccgg
<<<<<..<<<...........>>>.<<<<<<>.>>>>>.<<<..>>>..<
<<<<.......>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nqp How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Q45 V46 N48 R78 A81 A82 L85 A89 N90
Binding residue
(residue number reindexed from 1)		Q39 V40 N42 R72 A75 A76 L79 A83 N84
Enzymatic activity
Catalytic site (original residue number in PDB) R58 D60 R205
Catalytic site (residue number reindexed from 1) R52 D54 R199
Enzyme Commision number 5.4.99.12: tRNA pseudouridine(38-40) synthase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0042803 protein homodimerization activity
GO:0106029 tRNA pseudouridine synthase activity
GO:0140098 catalytic activity, acting on RNA
GO:0160147 tRNA pseudouridine(38-40) synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2nqp, PDBe:2nqp, PDBj:2nqp
PDBsum2nqp
PubMed17466622
UniProtP07649|TRUA_ECOLI tRNA pseudouridine synthase A (Gene Name=truA)

[Back to BioLiP]