Structure of PDB 2mkp Chain C Binding Site BS01

Receptor Information
>2mkp Chain C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ
NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mkp Conformation of the critical pH sensitive region of troponin depends upon a single residue in troponin I.
ResolutionN/A
Binding residue
(original residue number in PDB)		E19 A22 A23 V44 M47 L48 Q50 P52 M81 C84 M85
Binding residue
(residue number reindexed from 1)		E19 A22 A23 V44 M47 L48 Q50 P52 M81 C84 M85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2mkp, PDBe:2mkp, PDBj:2mkp
PDBsum2mkp
PubMed24333682
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]