Structure of PDB 2jz3 Chain C Binding Site BS01

Receptor Information
>2jz3 Chain C (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIP
SHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jz3 The SOCS box domain of SOCS3: structure and interaction with the elonginBC-cullin5 ubiquitin ligase
ResolutionN/A
Binding residue
(original residue number in PDB)		K72 V73 Y76 K80 Y83 I90 E92 F93 I95 A100 L103 L104 A107 N108 C112
Binding residue
(residue number reindexed from 1)		K56 V57 Y60 K64 Y67 I74 E76 F77 I79 A84 L87 L88 A91 N92 C96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process

View graph for
Biological Process
External links
PDB RCSB:2jz3, PDBe:2jz3, PDBj:2jz3
PDBsum2jz3
PubMed18590740
UniProtP83940|ELOC_MOUSE Elongin-C (Gene Name=Eloc)

[Back to BioLiP]