Structure of PDB 2jet Chain C Binding Site BS01

Receptor Information
>2jet Chain C (length=93) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLV
CQKDGVWTLAGIVSWGSGVCSTSTPGVYSRVTALMPWVQQILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jet The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q157 V206 W207
Binding residue
(residue number reindexed from 1)		Q7 V56 W57
Enzymatic activity
Catalytic site (original residue number in PDB) M192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) M42 G43 D44 S45 G46
Enzyme Commision number 3.4.21.1: chymotrypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2jet, PDBe:2jet, PDBj:2jet
PDBsum2jet
PubMed17805946
UniProtP07338|CTRB1_RAT Chymotrypsinogen B (Gene Name=Ctrb1)

[Back to BioLiP]