Structure of PDB 2hwn Chain C Binding Site BS01

Receptor Information
>2hwn Chain C (length=40) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREAR
Ligand information
>2hwn Chain F (length=20) Species: 9541 (Macaca fascicularis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EELAWKIAKMIVSDVMQQCK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hwn A Dynamic Mechanism for AKAP Binding to RII Isoforms of cAMP-Dependent Protein Kinase.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		I5 L13 Q14 T17 V18 L21 R22
Binding residue
(residue number reindexed from 1)		I2 L10 Q11 T14 V15 L18 R19
Enzymatic activity
Enzyme Commision number 2.7.11.11: cAMP-dependent protein kinase.
External links
PDB RCSB:2hwn, PDBe:2hwn, PDBj:2hwn
PDBsum2hwn
PubMed17081990
UniProtP12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=Prkar2a)

[Back to BioLiP]