Structure of PDB 2hvy Chain C Binding Site BS01

Receptor Information
>2hvy Chain C (length=53) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREV
LGI
Ligand information
>2hvy Chain E (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggguccgccuugagugcccgggugagaagcaugaucccggguaauuaugg
cggacccacag
<<<<<<<<<......<<<<<<<.............>>>>>>>......>>
>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hvy Crystal structure of an H/ACA box ribonucleoprotein particle
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R34 S36
Binding residue
(residue number reindexed from 1)		R32 S34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030515 snoRNA binding
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hvy, PDBe:2hvy, PDBj:2hvy
PDBsum2hvy
PubMed16943774
UniProtQ8U1R4|NOP10_PYRFU Ribosome biogenesis protein Nop10 (Gene Name=nop10)

[Back to BioLiP]