Structure of PDB 2fo5 Chain C Binding Site BS01

Receptor Information
>2fo5 Chain C (length=224) Species: 4513 (Hordeum vulgare) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLS
EQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNV
ARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFY
SEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRV
EKDSGASGGLCGIAMEASYPVKTY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fo5 Heterologous Expression, Purification, Refolding, and Structural-Functional Characterization of EP-B2, a Self-Activating Barley Cysteine Endoprotease.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G26 C28 Q68 G69 G70 L71 M72 D166
Binding residue
(residue number reindexed from 1)		G24 C26 Q66 G67 G68 L69 M70 D164
Enzymatic activity
Catalytic site (original residue number in PDB) Q22 C28 H167 N188
Catalytic site (residue number reindexed from 1) Q20 C26 H165 N186
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2fo5, PDBe:2fo5, PDBj:2fo5
PDBsum2fo5
PubMed16793521
UniProtP25250|CYSP2_HORVU Cysteine proteinase EP-B 2 (Gene Name=EPB2)

[Back to BioLiP]