Structure of PDB 2e76 Chain C Binding Site BS01

Receptor Information

>2e76 Chain C (length=288) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVV
KIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGD
VYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
LGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQ
TDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQ
DPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMN

Ligand information

>2e76 Chain H (length=29) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MEIDVLGWVALLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2e76 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
Resolution	3.41 Å
Binding residue (original residue number in PDB)	Q38 S39 L41 T44 I259 I262 M266 Q269 L270 I273 K276 K277
Binding residue (residue number reindexed from 1)	Q38 S39 L41 T44 I259 I262 M266 Q269 L270 I273 K276 K277

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2e76, PDBe:2e76, PDBj:2e76
PDBsum	2e76
PubMed	17498743
UniProt	P83793\|CYF_MASLA Cytochrome f (Gene Name=petA)

[Back to BioLiP]