Structure of PDB 2drm Chain C Binding Site BS01

Receptor Information
>2drm Chain C (length=58) Species: 5754 (Acanthamoeba) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWV
PANYVQDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2drm The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
Resolution1.35 Å
Binding residue
(original residue number in PDB)		Y11 D12 Y13 D19 E20 Q33 W39 E41 R48 W50 N54 Y55
Binding residue
(residue number reindexed from 1)		Y10 D11 Y12 D18 E19 Q32 W38 E40 R47 W49 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2drm, PDBe:2drm, PDBj:2drm
PDBsum2drm
PubMed
UniProtP19706|MYSB_ACACA Myosin heavy chain IB (Gene Name=MIB)

[Back to BioLiP]