Structure of PDB 2d45 Chain C Binding Site BS01

Receptor Information
>2d45 Chain C (length=117) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYK
KGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVE
KEDLSQDEIEELRNILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d45 Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		S9 A11 W40 S41 K43 T44 T47 R51
Binding residue
(residue number reindexed from 1)		S5 A7 W36 S37 K39 T40 T43 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2d45, PDBe:2d45, PDBj:2d45
PDBsum2d45
PubMed16582476
UniProtP68261|MECI_STAAN Methicillin resistance regulatory protein MecI (Gene Name=mecI)

[Back to BioLiP]