Structure of PDB 2d1x Chain C Binding Site BS01

Receptor Information
>2d1x Chain C (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVC
KGRYGLFPANYVELRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d1x Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y12 E21 G39 W40 L51 N55 Y56
Binding residue
(residue number reindexed from 1)		Y17 E26 G44 W45 L56 N60 Y61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2d1x, PDBe:2d1x, PDBj:2d1x
PDBsum2d1x
PubMed16636290
UniProtQ14247|SRC8_HUMAN Src substrate cortactin (Gene Name=CTTN)

[Back to BioLiP]