Structure of PDB 2d0n Chain C Binding Site BS01

Receptor Information
>2d0n Chain C (length=56) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPAN
YVAPMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d0n Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Resolution1.57 Å
Binding residue
(original residue number in PDB)		L293 R304
Binding residue
(residue number reindexed from 1)		L28 R39
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2d0n, PDBe:2d0n, PDBj:2d0n
PDBsum2d0n
PubMed17010654
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]