Structure of PDB 2b2e Chain C Binding Site BS01

Receptor Information
>2b2e Chain C (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLSMKLTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b2e Structural basis of RNA binding discrimination between bacteriophages Qbeta and MS2
Resolution3.15 Å
Binding residue
(original residue number in PDB)		K43 T45 S47 K61 Y85
Binding residue
(residue number reindexed from 1)		K43 T45 S47 K61 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2b2e, PDBe:2b2e, PDBj:2b2e
PDBsum2b2e
PubMed16531233
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]