Structure of PDB 2auc Chain C Binding Site BS01

Receptor Information
>2auc Chain C (length=126) Species: 5850 (Plasmodium knowlesi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQY
LEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTE
QEANDALNAFSSEDRINYKLFCEDIL
Ligand information
>2auc Chain D (length=13) Species: 73239 (Plasmodium yoelii yoelii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLMRVQAHIRKRM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2auc Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L145 M148 I168 L169 W172 G173 D174 A175 L176 D202 I203
Binding residue
(residue number reindexed from 1)		L67 M70 I90 L91 W94 G95 D96 A97 L98 D124 I125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
Cellular Component
GO:0016460 myosin II complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2auc, PDBe:2auc, PDBj:2auc
PDBsum2auc
PubMed16547135
UniProtD0VWV5

[Back to BioLiP]