Structure of PDB 2atw Chain C Binding Site BS01

Receptor Information
>2atw Chain C (length=225) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPG
ESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEIADGS
VEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEK
IDIIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIG
KEGQNARLAARLTGWRIDIRGDAPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2atw Structure of a Mycobacterium tuberculosis NusA-RNA complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		E199 R217 N230 K232 G233 A234 I236 G237 P238 M239 R242 K254 I255 D256 I257 S273 P274 F297 Q298 S300 L301 I303 K305 E306 G307 R311 R320 I321 D322 I323
Binding residue
(residue number reindexed from 1)		E95 R113 N126 K128 G129 A130 I132 G133 P134 M135 R138 K150 I151 D152 I153 S169 P170 F193 Q194 S196 L197 I199 K201 E202 G203 R207 R216 I217 D218 I219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0031564 transcription antitermination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2atw, PDBe:2atw, PDBj:2atw
PDBsum2atw
PubMed16193062
UniProtP9WIV3|NUSA_MYCTU Transcription termination/antitermination protein NusA (Gene Name=nusA)

[Back to BioLiP]