Structure of PDB 2ast Chain C Binding Site BS01

Receptor Information
>2ast Chain C (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGW
VHYMIHEPEPHILLFRRPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ast Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y3008 K3011 R3020 R3044 Q3049 Q3050 S3051
Binding residue
(residue number reindexed from 1)		Y4 K7 R16 R40 Q45 Q46 S47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity

View graph for
Molecular Function
External links
PDB RCSB:2ast, PDBe:2ast, PDBj:2ast
PDBsum2ast
PubMed16209941
UniProtP61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 (Gene Name=CKS1B)

[Back to BioLiP]