Structure of PDB 2ap2 Chain C Binding Site BS01

Receptor Information
>2ap2 Chain C (length=240) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVRDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPG
QPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQND
YSYPLTFGAGTKLEPEVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMH
WVKQRPEQGLEWIGRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSS
LTSEDTAVYYCARREVYSYYSPLDVWGAGTTVTVPSGSEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ap2 Antibody C219 recognizes an alpha-helical epitope on P-glycoprotein.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y38 D97 Y98 S99 Y100 K142 F145 D164 R211 V213 S215 Y216 Y217
Binding residue
(residue number reindexed from 1)
Y41 D100 Y101 S102 Y103 K145 F148 D167 R214 V216 S218 Y219 Y220
Enzymatic activity
Enzyme Commision number ?
External links