Structure of PDB 2an6 Chain C Binding Site BS01

Receptor Information

>2an6 Chain C (length=191) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSL
DAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFML
VLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPR
SIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Ligand information

>2an6 Chain G (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LRPVAMVRPTV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2an6 Elucidation of the substrate binding site of Siah ubiquitin ligase
Resolution	3.0 Å
Binding residue (original residue number in PDB)	D162 I163 V164 L166 T168 A175 V176 D177 W178 M180 N276
Binding residue (residue number reindexed from 1)	D71 I72 V73 L75 T77 A84 V85 D86 W87 M89 N185

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding

	Biological Process
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007275	multicellular organism development

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2an6, PDBe:2an6, PDBj:2an6
PDBsum	2an6
PubMed	16615911
UniProt	P61092\|SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A (Gene Name=Siah1a)

[Back to BioLiP]