Structure of PDB 1zaa Chain C Binding Site BS01

Receptor Information
>1zaa Chain C (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zaa Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R3 R14 R18 E21 R24 H25 I28 R42 F44 R46 H49 H53 T56 R70 R74 R80
Binding residue
(residue number reindexed from 1)		R1 R12 R16 E19 R22 H23 I26 R40 F42 R44 H47 H51 T54 R68 R72 R78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1zaa, PDBe:1zaa, PDBj:1zaa
PDBsum1zaa
PubMed2028256
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]