Structure of PDB 1ytf Chain C Binding Site BS01

Receptor Information

>1ytf Chain C (length=46) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV

Ligand information

>1ytf Chain E (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtatgtatataaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ytf Crystal structure of a yeast TFIIA/TBP/DNA complex.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	R257 K259
Binding residue (residue number reindexed from 1)	R17 K19
Binding affinity	PDBbind-CN: Kd=20pM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006367	transcription initiation at RNA polymerase II promoter

	Cellular Component
GO:0005672	transcription factor TFIIA complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ytf, PDBe:1ytf, PDBj:1ytf
PDBsum	1ytf
PubMed	8610010
UniProt	P32773\|TOA1_YEAST Transcription initiation factor IIA large subunit (Gene Name=TOA1)

[Back to BioLiP]