Structure of PDB 1ysh Chain C Binding Site BS01

Receptor Information
>1ysh Chain C (length=104) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKKSGENINNKLQLVMKSGKYTLGYKTVLKTLRSSKGKLIILANNCPPL
RKSEIEYYAMLAKISVHHFHGNNVDLGTACGKYYRVCCLSILDPGDSDII
STTT
Ligand information
>1ysh Chain F (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacuccguggaagccguaauggcaggaagcgga
....<<<<<....<<<<...>>>>.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ysh Localization and dynamic behavior of ribosomal protein L30e
Resolution9.5 Å
Binding residue
(original residue number in PDB)		L24 G25 Y26 K27 T28 P48 R51 Y84 R85
Binding residue
(residue number reindexed from 1)		L24 G25 Y26 K27 T28 P48 R51 Y84 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ysh, PDBe:1ysh, PDBj:1ysh
PDBsum1ysh
PubMed15864315
UniProtQ5I7K9|RL30_WHEAT Large ribosomal subunit protein eL30

[Back to BioLiP]