Structure of PDB 1yo5 Chain C Binding Site BS01

Receptor Information

>1yo5 Chain C (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKN
RPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHP

Ligand information

>1yo5 Chain A (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tagcaggatgtgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1yo5 Analysis of the 2.0 A Crystal Structure of the Protein-DNA Complex of the Human PDEF Ets Domain Bound to the Prostate Specific Antigen Regulatory Site
Resolution	2.0 Å
Binding residue (original residue number in PDB)	S284 Y302 R307 R310 Y313 K320 R326 L327 Y329
Binding residue (residue number reindexed from 1)	S38 Y56 R61 R64 Y67 K74 R80 L81 Y83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1yo5, PDBe:1yo5, PDBj:1yo5
PDBsum	1yo5
PubMed	15882048
UniProt	O95238\|SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor (Gene Name=SPDEF)

[Back to BioLiP]