Structure of PDB 1yfn Chain C Binding Site BS01

Receptor Information
>1yfn Chain C (length=107) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLN
IAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMF
EPEAAYD
Ligand information
>1yfn Chain E (length=18) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EAQPAPHQWQKMPFWQKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yfn Versatile modes of peptide recognition by the AAA+ adaptor protein SspB
Resolution1.8 Å
Binding residue
(original residue number in PDB)		T35 L36 P37 G38 E69
Binding residue
(residue number reindexed from 1)		T31 L32 P33 G34 E65
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1yfn, PDBe:1yfn, PDBj:1yfn
PDBsum1yfn
PubMed15880122
UniProtP0AFZ3|SSPB_ECOLI Stringent starvation protein B (Gene Name=sspB)

[Back to BioLiP]