Structure of PDB 1xv9 Chain C Binding Site BS01

Receptor Information
>1xv9 Chain C (length=232) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQL
FTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILL
ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLF
NPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALR
SIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xv9 A Structural Basis for Constitutive Activity in the Human CAR/RXRalpha Heterodimer.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
V280 K284 L294 Q297 V298 L301 R302 F450 E453 E456
Binding residue
(residue number reindexed from 1)
V54 K58 L68 Q71 V72 L75 R76 F224 E227 E230
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1xv9, PDBe:1xv9, PDBj:1xv9
PDBsum1xv9
PubMed15610735
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]