Structure of PDB 1xq7 Chain C Binding Site BS01

Receptor Information
>1xq7 Chain C (length=166) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGY
KGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVS
MANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGL
NDKPKKAVKINDCGVL
Ligand information
>1xq7 Chain F (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xq7 Cyclophilin from Trypanosoma Cruzi Bound to Cyclosporin A
Resolution2.07 Å
Binding residue
(original residue number in PDB)
R57 F62 Q65 G74 A102 N103 Q112 F114 W122 H127
Binding residue
(residue number reindexed from 1)
R57 F62 Q65 G74 A102 N103 Q112 F114 W122 H127
Enzymatic activity
Catalytic site (original residue number in PDB) R57 F62 Q65 N103 F114 L123 H127
Catalytic site (residue number reindexed from 1) R57 F62 Q65 N103 F114 L123 H127
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1xq7, PDBe:1xq7, PDBj:1xq7
PDBsum1xq7
PubMed
UniProtQ4DPB9

[Back to BioLiP]