Structure of PDB 1wsu Chain C Binding Site BS01

Receptor Information
>1wsu Chain C (length=102) Species: 1525 (Moorella thermoacetica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLLKDLEDKYRVSRWQPPSFKEVAEELLHYLVREGVLVKINDEFYWHRQA
LGEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRKRV
VV
Ligand information
>1wsu Chain G (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcguugccgguggcaacgcc
<<<<<<<<<...>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wsu Structural basis for mRNA recognition by elongation factor SelB
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R599 S605 R606 K607 L610
Binding residue
(residue number reindexed from 1)		R73 S79 R80 K81 L84
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003746 translation elongation factor activity
GO:0005525 GTP binding
Biological Process
GO:0001514 selenocysteine incorporation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1wsu, PDBe:1wsu, PDBj:1wsu
PDBsum1wsu
PubMed15665870
UniProtQ46455|SELB_MOOTH Selenocysteine-specific elongation factor (Gene Name=selB)

[Back to BioLiP]