Structure of PDB 1ws4 Chain C Binding Site BS01

Receptor Information
>1ws4 Chain C (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>1ws4 Chain B (length=16) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSGISQTVIVGPWGAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ws4 Structural basis for the energetics of jacalin-sugar interactions: promiscuity versus specificity
Resolution1.9 Å
Binding residue
(original residue number in PDB)
N105 P107 E109 N110 L133
Binding residue
(residue number reindexed from 1)
N105 P107 E109 N110 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ws4, PDBe:1ws4, PDBj:1ws4
PDBsum1ws4
PubMed15733927
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]