Structure of PDB 1vzj Chain C Binding Site BS01

Receptor Information
>1vzj Chain C (length=32) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vzj The Synaptic Acetylcholinesterase Tetramer Assembles Around a Polyproline-II Helix
Resolution2.35 Å
Binding residue
(original residue number in PDB)		L3 E7 W10 W17 M21 W24 Q27 F28 Y31
Binding residue
(residue number reindexed from 1)		L3 E7 W10 W17 M21 W24 Q27 F28 Y31
Enzymatic activity
Enzyme Commision number 3.1.1.7: acetylcholinesterase.
External links
PDB RCSB:1vzj, PDBe:1vzj, PDBj:1vzj
PDBsum1vzj
PubMed15526038
UniProtP22303|ACES_HUMAN Acetylcholinesterase (Gene Name=ACHE)

[Back to BioLiP]