Structure of PDB 1vtn Chain C Binding Site BS01

Receptor Information
>1vtn Chain C (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNS
IRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFK
LA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vtn Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S123 Y124 N165 S166 H169 L209 R210 R211 R214
Binding residue
(residue number reindexed from 1)		S7 Y8 N49 S50 H53 L93 R94 R95 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1vtn, PDBe:1vtn, PDBj:1vtn
PDBsum1vtn
PubMed8332212
UniProtP55318|FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma (Gene Name=FOXA3)

[Back to BioLiP]