Structure of PDB 1vg8 Chain C Binding Site BS01

Receptor Information
>1vg8 Chain C (length=178) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRL
VTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEF
LIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSA
KEAINVEQAFQTIARNALKQETEVELYN
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain1vg8 Chain C Residue 3401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vg8 Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T3022 T3040
Binding residue
(residue number reindexed from 1)		T16 T34
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031267 small GTPase binding
GO:1905394 retromer complex binding
Biological Process
GO:0000045 autophagosome assembly
GO:0006622 protein targeting to lysosome
GO:0006914 autophagy
GO:0007174 epidermal growth factor catabolic process
GO:0008333 endosome to lysosome transport
GO:0009617 response to bacterium
GO:0015031 protein transport
GO:0016042 lipid catabolic process
GO:0019076 viral release from host cell
GO:0022615 protein to membrane docking
GO:0036466 synaptic vesicle recycling via endosome
GO:0042147 retrograde transport, endosome to Golgi
GO:0045022 early endosome to late endosome transport
GO:0045453 bone resorption
GO:0045732 positive regulation of protein catabolic process
GO:0046907 intracellular transport
GO:0048524 positive regulation of viral process
GO:0051650 establishment of vesicle localization
GO:0061724 lipophagy
GO:0090383 phagosome acidification
GO:0090385 phagosome-lysosome fusion
GO:0098943 neurotransmitter receptor transport, postsynaptic endosome to lysosome
GO:0099003 vesicle-mediated transport in synapse
GO:0099638 endosome to plasma membrane protein transport
GO:1903542 negative regulation of exosomal secretion
GO:1903543 positive regulation of exosomal secretion
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0030672 synaptic vesicle membrane
GO:0030904 retromer complex
GO:0031902 late endosome membrane
GO:0031966 mitochondrial membrane
GO:0033162 melanosome membrane
GO:0034045 phagophore assembly site membrane
GO:0043195 terminal bouton
GO:0043231 intracellular membrane-bounded organelle
GO:0045335 phagocytic vesicle
GO:0097208 alveolar lamellar body
GO:0098588 bounding membrane of organelle
GO:0098830 presynaptic endosome
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vg8, PDBe:1vg8, PDBj:1vg8
PDBsum1vg8
PubMed15186776
UniProtP09527|RAB7A_RAT Ras-related protein Rab-7a (Gene Name=Rab7a)

[Back to BioLiP]