Structure of PDB 1v15 Chain C Binding Site BS01

Receptor Information
>1v15 Chain C (length=129) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDD
FRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELH
ADKPISQGGEVYDMDNIRVTTPKRHIDIH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1v15 Structure-Based Analysis of the Metal-Dependent Mechanism of H-N-H Endonucleases
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R5 D51 R54 Y83 S84 E100 L101 H102 H127
Binding residue
(residue number reindexed from 1)		R3 D49 R52 Y81 S82 E98 L99 H100 H125
Enzymatic activity
Catalytic site (original residue number in PDB) R5 R96 E100 H102 A103 H127 H131
Catalytic site (residue number reindexed from 1) R3 R94 E98 H100 A101 H125 H129
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1v15, PDBe:1v15, PDBj:1v15
PDBsum1v15
PubMed15190054
UniProtP09883|CEA9_ECOLX Colicin-E9 (Gene Name=col)

[Back to BioLiP]