Structure of PDB 1t2v Chain C Binding Site BS01

Receptor Information
>1t2v Chain C (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCE
RTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQG
PKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSF
THPIVVVQPDAWTFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQ
IP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2v Structural basis of phosphopeptide recognition by the BRCT domain of BRCA1
Resolution3.3 Å
Binding residue
(original residue number in PDB)
C1768 G1770 P1771 F1772 N1774 P1776 T1777 K1793 E1794
Binding residue
(residue number reindexed from 1)
C120 G122 P123 F124 N126 P128 T129 K145 E146
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1t2v, PDBe:1t2v, PDBj:1t2v
PDBsum1t2v
PubMed15133503
UniProtP38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]