Structure of PDB 1sds Chain C Binding Site BS01

Receptor Information
>1sds Chain C (length=112) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKP
EEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEE
LKVLIEKVNVLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sds Structure of Protein L7Ae Bound to a K-Turn Derived from an Archaeal Box H/ACA sRNA at 1.8 A Resolution.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q25 K44 N98 E99 A102
Binding residue
(residue number reindexed from 1)		Q21 K40 N94 E95 A98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034512 box C/D sno(s)RNA binding
Biological Process
GO:0000492 box C/D snoRNP assembly
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0031428 box C/D methylation guide snoRNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sds, PDBe:1sds, PDBj:1sds
PDBsum1sds
PubMed15130481
UniProtP54066|RL7A_METJA Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]