Structure of PDB 1s9k Chain C Binding Site BS01

Receptor Information

>1s9k Chain C (length=280) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGY
MENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKV
LEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMIL
TGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNK
HIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Ligand information

>1s9k Chain A (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttgaaaatatgtgtaatag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1s9k Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site
Resolution	3.1 Å
Binding residue (original residue number in PDB)	R421 S429 R430 R537 Q571 R665
Binding residue (residue number reindexed from 1)	R23 S31 R32 R139 Q173 R267

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1s9k, PDBe:1s9k, PDBj:1s9k
PDBsum	1s9k
PubMed
UniProt	Q13469\|NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 (Gene Name=NFATC2)

[Back to BioLiP]