Structure of PDB 1ry1 Chain C Binding Site BS01

Receptor Information
>1ry1 Chain C (length=71) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTD
QAQDVKKIEKFHSQLMRLMVA
Ligand information
>1ry1 Chain E (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccgggcgcgguggcgcgcgccuguagucccagcuacucgggaggcuc
<<<<<<<<<<<..(((.>>>>>>>....<<<<.)))....>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ry1 Structure of the signal recognition particle interacting with the elongation-arrested ribosome
Resolution12.0 Å
Binding residue
(original residue number in PDB)		R26 K30 R32
Binding residue
(residue number reindexed from 1)		R22 K26 R28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005047 signal recognition particle binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005785 signal recognition particle receptor complex
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ry1, PDBe:1ry1, PDBj:1ry1
PDBsum1ry1
PubMed14985753
UniProtP49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)

[Back to BioLiP]