Structure of PDB 1rpq Chain C Binding Site BS01

Receptor Information
>1rpq Chain C (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKVSLNPPWNRIFKGENVTLTCNGNNFVSSTKWFHNGSLSEETNSSLNI
VNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFL
RCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rpq Convergent Recognition of the IgE Binding Site on the High-Affinity IgE Receptor.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
F60 S85 D86 W87 W110 R111 W113 W156 L158 Y160
Binding residue
(residue number reindexed from 1)
F55 S80 D81 W82 W105 R106 W108 W151 L153 Y155
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1rpq, PDBe:1rpq, PDBj:1rpq
PDBsum1rpq
PubMed15242605
UniProtP12319|FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha (Gene Name=FCER1A)

[Back to BioLiP]