Structure of PDB 1rlq Chain C Binding Site BS01

Receptor Information
>1rlq Chain C (length=56) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rlq Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y14 D23 D41 W42 P57 Y60
Binding residue
(residue number reindexed from 1)		Y6 D15 D33 W34 P49 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:1rlq, PDBe:1rlq, PDBj:1rlq
PDBsum1rlq
PubMed7526465
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]