Structure of PDB 1rjl Chain C Binding Site BS01

Receptor Information
>1rjl Chain C (length=95) Species: 139 (Borreliella burgdorferi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVEIKEGTVTLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISAD
SKKTKDLVFLTDGTITVQQYNTAGTSLEGSASEIKNLSELKNALK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rjl Structural Investigation of Borrelia burgdorferi OspB, a BactericidalFab Target.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T202 V203 E204 K206
Binding residue
(residue number reindexed from 1)		T1 V2 E3 K5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009279 cell outer membrane

View graph for
Cellular Component
External links
PDB RCSB:1rjl, PDBe:1rjl, PDBj:1rjl
PDBsum1rjl
PubMed15713683
UniProtP17739|OSPB_BORBU Outer surface protein B (Gene Name=ospB)

[Back to BioLiP]