Structure of PDB 1r71 Chain C Binding Site BS01

Receptor Information
>1r71 Chain C (length=112) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHV
TLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEIT
RGTVKLLREFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r71 Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K180 S181 A183 F184 D209 V210 T211 R240
Binding residue
(residue number reindexed from 1)		K41 S42 A44 F45 D70 V71 T72 R101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1r71, PDBe:1r71, PDBj:1r71
PDBsum1r71
PubMed15170177
UniProtP07674|KORB2_ECOLX Transcriptional repressor protein KorB (Gene Name=korB)

[Back to BioLiP]