Structure of PDB 1qsc Chain C Binding Site BS01

Receptor Information
>1qsc Chain C (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGR
IPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALL
RWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLF
CPVSKMEAKNSYVRDDAIFIKAIVDLTGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qsc Crystallographic analysis of CD40 recognition and signaling by human TRAF2.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R393 Y395 D399 F410 F447 R448 D450 S455 A466 S467 G468 P470
Binding residue
(residue number reindexed from 1)		R71 Y73 D77 F88 F125 R126 D128 S133 A144 S145 G146 P148
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0042981 regulation of apoptotic process
GO:0046328 regulation of JNK cascade
GO:0051865 protein autoubiquitination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qsc, PDBe:1qsc, PDBj:1qsc
PDBsum1qsc
PubMed10411888
UniProtQ12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Gene Name=TRAF2)

[Back to BioLiP]