Structure of PDB 1qs7 Chain C Binding Site BS01

Receptor Information
>1qs7 Chain C (length=144) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE
VDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAE
LRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qs7 Target Enzyme Recognition by Calmodulin: 2.4 A Structure of a Calmodulin- Peptide Complex
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E11 F12 E14 A15 F19 M36 M51 L71 M72 M76 E84 A88 F92 L105 M109 L112 E114 M124 A128 F141 V144 M145
Binding residue
(residue number reindexed from 1)		E7 F8 E10 A11 F15 M32 M47 L67 M68 M72 E80 A84 F88 L101 M105 L108 E110 M120 A124 F137 V140 M141
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V31
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:1qs7, PDBe:1qs7, PDBj:1qs7
PDBsum1qs7
PubMed
UniProtA0MMD0

[Back to BioLiP]