Structure of PDB 1pyo Chain C Binding Site BS01

Receptor Information
>1pyo Chain C (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGG
DVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIV
ALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRG
DETDRGVDQQD
Ligand information
>1pyo Chain F (length=5) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDESD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pyo Crystal structure of caspase-2, apical initiator of the intrinsic apoptotic pathway.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R54 H112 Q153 C155
Binding residue
(residue number reindexed from 1)		R47 H105 Q146 C148
Enzymatic activity
Catalytic site (original residue number in PDB) E52 F53 G113 C155
Catalytic site (residue number reindexed from 1) E45 F46 G106 C148
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pyo, PDBe:1pyo, PDBj:1pyo
PDBsum1pyo
PubMed12920126
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]