Structure of PDB 1prl Chain C Binding Site BS01

Receptor Information
>1prl Chain C (length=56) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1prl Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y16 D23 W42 N59 Y60
Binding residue
(residue number reindexed from 1)		Y8 D15 W34 N51 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:1prl, PDBe:1prl, PDBj:1prl
PDBsum1prl
PubMed7526465
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]