Structure of PDB 1pdn Chain C Binding Site BS01

Receptor Information
>1pdn Chain C (length=123) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVS
KILNRYQETGSIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIRE
KLIREGVCDRSTAPSVSAISRLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pdn Crystal structure of a paired domain-DNA complex at 2.5 A resolution reveals structural basis for Pax developmental mutations.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N14 G15 R16 R35 P36 C37 R41 H47 S51 G69 G70 S71
Binding residue
(residue number reindexed from 1)		N13 G14 R15 R34 P35 C36 R40 H46 S50 G68 G69 S70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pdn, PDBe:1pdn, PDBj:1pdn
PDBsum1pdn
PubMed7867071
UniProtP06601|PRD_DROME Segmentation protein paired (Gene Name=prd)

[Back to BioLiP]